PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007255m
Common NameCARUB_v10007255mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 263aa    MW: 30301.3 Da    PI: 9.3766
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007255mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.4e-19855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+++v+ +G g+W+++ar  g++R +k+c++rw +yl
  Carubv10007255m  8 KGPWTAEEDRLLIEYVRVHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding53.46e-1761105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
  Carubv10007255m  61 RGQITPHEESIIIELHAKWGNR-WSTIARSLP-GRTDNEIKNYWRTH 105
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.362155IPR017930Myb domain
SuperFamilySSF466892.58E-307102IPR009057Homeodomain-like
SMARTSM007171.1E-16757IPR001005SANT/Myb domain
PfamPF002492.1E-17855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-24962IPR009057Homeodomain-like
CDDcd001672.32E-121055No hitNo description
PROSITE profilePS5129425.01856110IPR017930Myb domain
SMARTSM007172.6E-1560108IPR001005SANT/Myb domain
PfamPF002493.7E-1461105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2463109IPR009057Homeodomain-like
CDDcd001676.16E-1165106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MVEEVWRKGP WTAEEDRLLI EYVRVHGEGR WNSVARLAGL KRNGKSCRLR WVNYLRPDLK  60
RGQITPHEES IIIELHAKWG NRWSTIARSL PGRTDNEIKN YWRTHFKKKA KPTTNNVEKT  120
KSRLLKREQF KQQRELEMQQ EQQLFQFDQL DMKKIISLLE DNNSTSSSDC GSNGNVFYAP  180
HQVTHSSKPF GYNPNLLEEQ LQGRLAPVNI LDANTTNEDN AIWDGLWNMD IVDGHGGMSV  240
VAATSACGPR KPYFHNLVIP FC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-26811027128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1337050.0AY133705.1 Arabidopsis thaliana clone C103160 putative myb protein (At4g13480) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285781.10.0hypothetical protein CARUB_v10007255mg
TrEMBLR0GP770.0R0GP77_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.9__1__AT4G13480.11e-154(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-149myb domain protein 79